Glycan Array Experiment: primscreen_6599

Glycan Array ID : primscreen_6599
Sample Name : AcmJRL
Sample Category : Plant Lectins
Investigator: : Alexander Titz
Download Data:
File: 3693_AcmJRL_5_50ugml_Data.xlsm
Conclusive
Sample Information:
Name : AcmJRL
Complete Name : Ananas jacalin-related lectin
Family : Plant/Fungal Lectin
Sub Family : jacalin-related lectin
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : Ananas comosus
Estimated Purity : >90%
Mutation/Chimera : Information not entered/not applicable.
Entry Date [yyyy-mm-dd] : 2021-03-11
Status : Private
Primary Sequence :
1sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng61gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas121grivafygrfgslvdafgiylmpy
Comments :
We have affinity purified the lectin on a mannosylated resin and showed mannose binding in solution
Known Sites of Expression :
Azarkan et al., Scientific Reports volume 8, Article number: 11508 (2018)
External References :
Swissprot : Information not entered/not applicable.
Genbank : Information not entered/not applicable.
Experiment Information:
Status: : Public
Title/Project Description: : Information not entered/not applicable.
Associated Resource Requests: : cfg_rRequest_3693
Glycan Array Version: : PA_v52
Protocol Used: : Protocol Direct Binding
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 50 μg/ml
Experiment Date [yyyy-mm-dd]: : 2021-04-22
Supplying Investigator : Alexander Titz
Specific Assay Information : Assayed following standard Direct binding protocol. Sample was fluorescently labeled with Cy3.
Annotation : AcmJRL 50 and 5
Protein Sample Analyzed : AcmJRL