Glycan Array Experiment: primscreen_6593

Glycan Array ID : primscreen_6593
Sample Name : Streptosporangium roseum F-type lectin a-L-fucosidase
Sample Category : Plant Lectins
Investigator: : Ramya TNC
Download Data:
File: FTP_17008_GenePix_563_v5.2_RESULTS.xls
Conclusive
Sample Information:
Name : Streptosporangium roseum F-type lectin a-L-fucosidase
Complete Name : S. roseum fucosidase, S. roseum FLD
Family : Viral / Bacterial Lectin
Sub Family : F-type lectin/ CBM47
Gene Symbol : Information not entered/not applicable.
Synonyms : Information not entered/not applicable.
Species Common Name: : Information not entered/not applicable.
Species Scientific Name : Streptosporangium roseum
Estimated Purity : >85% purity, contaminants are expected to be E. coli BL21-DE3 proteins
Mutation/Chimera : C-ter hexahistidine tagged wildtype full length or separate domains, mutations in FLD and/or fucosidase domain
Entry Date [yyyy-mm-dd] : 2014-04-11
Status : Private
Primary Sequence :
MRRKLLLVPAVGLLVIGSIFATQPVASADTPPVYEPTVESLNSHPVPQWFNDDKFGIFIHWGAYSVPAWGPRGSYAEWYGNYMNAGGSATNAHHKATYGQDFNYDAFLQQWKAEKFDPADWVKLFKDAGAKYFVLTSKHHEGMALWDSKSSGRDSVDLGPGRDLAKELFDAARKDEAKLKAGFYYSLYEWYNPAYTGRPATNPYTGAEIPYTGAPGGGDYVKDYMLPQMRELIDGYDPDIIWCDGQWEKPASYWNTAGVIADYYNKALNSGKEVAVANRCKIQSGNLDSPELDFQTPEYTVKPDIDPVKWESSRGIAHSYGYNQNEPEEDHLTSDQLVDSLVDIVSKNGNLLLDIGPKADGTIPEIQRQRLLDIGAWLKANGEAIYGTTYWNRAEEKGGPDDVRYTAKDATLYATALKWPGEQLTLGADLPVDHSTRITMLGSGARLSWSRDEQGRVVVNTPQEAGKHAYVFKIETPGVRSLLRTSSSLAKEIAPGRTISGELTVTNPGKRHTPATKLSLTVPQGWTATLGAPRVRPLGPGESVKVPISVSAPEGVAPAPYTLGLYQRTGRMGTTTALPLTVNRPNLSLGKPATQKSTGYDAPASRAVDGNTGGDWSAGSTTHTAEPEKQAWWQVDLGASARLDSVDVWNRLDCCADRLKDFWVMASDQPFTTDDLDQARTAPGVTAVHVGEQAGSPSKVKLPEGTRGRYVRIQLASPSNPLSLAEVQVRGSrFLD(proteinwithjustF-typelectindomain)MARPNLSLGKPATQKSTGYDAPASRAVDGNTGGDWSAGSTTHTAEPEKQAWWQVDLGASARLDSVDVWNRLDCCADRLKDFWVMASDQPFTTDDLDQARTAPGVTAVHVGEQAGSPSKVKLPEGTRGRYVRIQLASPSNPLSLAEVQVRLEHHHHHHSrNPCBM(proteinwithNPCBM-associateddomain)MAVRSLLRTSSSLAKEIAPGRTISGELTVTNPGKRHTPATKLSLTVPQGWTATLGAPRVRPLGPGESVKVPISVSAPEGVAPAPYTLGLYQRTGRMGTTTALPLTVNLEHHHHHH
Comments :
Hemagglutination for confirming lectin activity A 2% suspension of human type-O erythrocytes is made in 20 mM Tris HCl, 10 mM CaCl2 0.15 M NaCl, pH 7.5 25 microlitres of the erythrocyte suspension is mixed with 25 microlitres of the recombinant protein solution in a U-bottomed microtitre plate and incubated at 37 C Hemagglutination is observed after 1 hour
Known Sites of Expression :
The gene encoding full length or separate F-type lectin domain or NPCBM associated domain of Streptosporangium roseum fucosidase without signal peptide and stop codon was cloned within NcoI and XhoI sites in pET28a(+) to enable expression of C-terminal His tagged protein. Cultures were grown till OD of 0.8, induced with 0.1 mM IPTG at 20 C for 10 hours, and then protein was purified from lysate by metal ion affinity chromatography. Lectin activity was confirmed by hemagglutination assay using type O erythrocytes.
External References :
Swissprot : D2B1P1_STRRD
Genbank : ACZ87343.1
Experiment Information:
Status: : Public
Title/Project Description: : The purpose of this request is to perform the analysis of Streptosporangium roseum fucosidase protein containing a fucosidase domain, an NPCBM domain and an F-type lectin domain, on the glycan array.
Associated Resource Requests: : cfg_rRequest_3001
Glycan Array Version: : PA_v52
Protocol Used: : Protocol Tertiary step
Replicate Number: : 1
Result Nature: : Data
Protein/Sample Concentration: : 100 μg/ml
Experiment Date [yyyy-mm-dd]: : 2014-08-08
Supplying Investigator : Ramya TNC
Specific Assay Information : Sample was diluted in binding buffer containing 10 mM CaCl2 and was detected with anti-His (Sigma, sent by PI, 1:1000) followed by detected with anti-rabbit IgG-488 (Invitrogen, 5 ug/ml).
Annotation : WT FTP
Protein Sample Analyzed : Streptosporangium roseum F-type lectin a-L-fucosidase